Amyloid Beta–Peptide (1–40) (human) (GLPBio, 10mg) — cas 131438-79-4

Amyloid Beta–Peptide (1–40) (human) cas: (131438-79-4)

nazwa: Amyloid Beta–Peptide (1–40) (human)

nr katalogowy: GP10118-10

cas: 131438-79-4

producent: GLPBio

opakowanie: 10mg

cena: 2539,45 [Pln] (bez rabatu)

wyszukaj podobne produkty: 131438-79-4

szczegóły:

Formula: C194H295N53O58S. Molecular weight: 4329,86. Solubility: ≥43.28mg/mL in DMSO. Storage: Desiccate at -20°C . Synonym: Amyloid β-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (Aβ or Abeta) is a peptide of 36–43 amino acids that is processed from the Amyloid precursor protein..

właściwości

czystość: No data

czas dostawy: Do potwierdzenia przez Chemat