nazwa: LL–37 (trifluoroacetate salt)

nr katalogowy: GC14377-5

cas: 154947-66-7

producent: GLPBio

opakowanie: 5mg

cena: 1266,35 [Pln] (bez rabatu)

wyszukaj podobne produkty: 154947-66-7

szczegóły:

Formula: C205H340N60O53 • XCF3COOH. Molecular weight: 4493,3. Solubility: Water: 1 mg/ml. Storage: Store at -20°C. Synonym: LL-37 contains 37 amino acid residues with the first two leucine residues (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) and mostly exists in epithelial cells and neutrophils..

właściwości

czystość: No data

czas dostawy: Do potwierdzenia przez Chemat