Nesfatin–1 (30–59) (mouse, rat) cas: (1872441-22-9)

nazwa: Nesfatin–1 (30–59) (mouse, rat)

nr katalogowy: GA23241-.5

cas: 1872441-22-9

producent: GLPBio

opakowanie: 0,5mg

cena: 1921,62 [Pln] (bez rabatu)

wyszukaj podobne produkty: 1872441-22-9


szczegóły:

Formula: C167H260N40O54. Molecular weight: 3692,14. Solubility: Soluble in DMSO. Storage: Store at -20°C. Synonym: Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment..

właściwości

czystość: No data

czas dostawy: Do potwierdzenia przez Chemat