nazwa: Nesfatin–1 (30–59) (mouse, rat)

nr katalogowy: GA23241-1

cas: 1872441-22-9

producent: GLPBio

opakowanie: 1mg

cena: 2647,10 [Pln] (bez rabatu)

wyszukaj podobne produkty: 1872441-22-9

szczegóły:

Formula: C167H260N40O54. Molecular weight: 3692,14. Solubility: Soluble in DMSO. Storage: Store at -20°C. Synonym: Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment..

właściwości

czystość: No data

czas dostawy: Do potwierdzenia przez Chemat