(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt

cas: 1802084-01-0 — see every product listed under this CAS number, including other names

(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt (CAS 1802084-01-0) is a chemical reagent available from Chemat. Available pack sizes: 1000ug, 500ug, 2000ug, 5000ug, 10000ug. Offered by: Biosynth.

brandBiosynth
catalog numberFA109837-1000ug
cas1802084-01-0
size1000ug
Need more information?

Ask us about this product — we're happy to help.

Available pack sizes

brand size price
Biosynth 1000ug price on request
Biosynth 500ug price on request
Biosynth 2000ug price on request
Biosynth 5000ug price on request
Biosynth 10000ug price on request

properties

categoryLife Sciences
purityNo data
delivery time4-6 weeks
Structural formula: {0} (CAS {1})

[2-[1-(3,4-dimethylphenyl)-2,5-dimethylpyrrol-3-yl]-2-oxoethyl] 2-[[(E)-2-phenylethenyl]sulfonylamino]acetate (CAS 1802084-01-0) is a chemical compound with the molecular formula C26H28N2O5S and a molecular weight of 480.6 g/mol. IUPAC name: [2-[1-(3,4-dimethylphenyl)-2,5-dimethylpyrrol-3-yl]-2-oxoethyl] 2-[[(E)-2-phenylethenyl]sulfonylamino]acetate. InChIKey: CVZKNIKDGXDQJX-OUKQBFOZSA-N.

Identity
Molecular formulaC26H28N2O5S
Molecular weight480.6 g/mol
IUPAC name[2-[1-(3,4-dimethylphenyl)-2,5-dimethylpyrrol-3-yl]-2-oxoethyl] 2-[[(E)-2-phenylethenyl]sulfonylamino]acetate
InChIKeyCVZKNIKDGXDQJX-OUKQBFOZSA-N
SMILESCC1=C(C=C(C=C1)N2C(=CC(=C2C)C(=O)COC(=O)CNS(=O)(=O)/C=C/C3=CC=CC=C3)C)C

Computed by PubChem (NCBI)

Synonyms: H-DARFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH, (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
Isomers (same molecular formula)
(4S,7S,12bR)-7-[[(2S)-2-acetylsulfanyl-3-phenylpropanoyl]amino]-6-oxo-2,3,4,7,8,12b-hexahydro-1H-pyrido[2,1-a][2]benzazepine-4-carboxylic acid C26H28N2O5S

Also listed as

(Arg3)-Amyloid β-Protein (1-40) Creative Peptides CAS 1802084-01-0