(Arg3)-Amyloid β-Protein (1-40)

cas: 1802084-01-0 — see every product listed under this CAS number, including other names

(Arg3)-Amyloid β-Protein (1-40) (CAS 1802084-01-0) is a chemical reagent available from Chemat. Available pack sizes: on request. Offered by: Creative Peptides.

brandCreative Peptides
catalog numberCP-CAD-003
cas1802084-01-0
sizeon request
Need more information?

Ask us about this product — we're happy to help.

Available pack sizes

brand size price
Creative Peptides on request price on request

properties

purityNo data
delivery timeTo be confirmed by Chemat
Structural formula: {0} (CAS {1})

[2-[1-(3,4-dimethylphenyl)-2,5-dimethylpyrrol-3-yl]-2-oxoethyl] 2-[[(E)-2-phenylethenyl]sulfonylamino]acetate (CAS 1802084-01-0) is a chemical compound with the molecular formula C26H28N2O5S and a molecular weight of 480.6 g/mol. IUPAC name: [2-[1-(3,4-dimethylphenyl)-2,5-dimethylpyrrol-3-yl]-2-oxoethyl] 2-[[(E)-2-phenylethenyl]sulfonylamino]acetate. InChIKey: CVZKNIKDGXDQJX-OUKQBFOZSA-N.

Identity
Molecular formulaC26H28N2O5S
Molecular weight480.6 g/mol
IUPAC name[2-[1-(3,4-dimethylphenyl)-2,5-dimethylpyrrol-3-yl]-2-oxoethyl] 2-[[(E)-2-phenylethenyl]sulfonylamino]acetate
InChIKeyCVZKNIKDGXDQJX-OUKQBFOZSA-N
SMILESCC1=C(C=C(C=C1)N2C(=CC(=C2C)C(=O)COC(=O)CNS(=O)(=O)/C=C/C3=CC=CC=C3)C)C

Computed by PubChem (NCBI)

Synonyms: H-DARFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH, (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
Isomers (same molecular formula)
(4S,7S,12bR)-7-[[(2S)-2-acetylsulfanyl-3-phenylpropanoyl]amino]-6-oxo-2,3,4,7,8,12b-hexahydro-1H-pyrido[2,1-a][2]benzazepine-4-carboxylic acid C26H28N2O5S

Also listed as

(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt Biosynth CAS 1802084-01-0