(Lys22)-Amyloid beta-Protein (1-40)
cas: 302905-01-7 — see every product listed under this CAS number, including other names
(Lys22)-Amyloid beta-Protein (1-40) (CAS 302905-01-7) is a chemical reagent available from Chemat. Available pack sizes: on request. Offered by: Creative Peptides.
| brand | Creative Peptides |
|---|---|
| catalog number | CP-A13389 |
| cas | 302905-01-7 |
| size | on request |
Need more information?
Ask us about this product — we're happy to help.
Available pack sizes
| brand | size | price | |
|---|---|---|---|
| Creative Peptides | on request | price on request |
properties
| purity | No data |
|---|---|
| delivery time | To be confirmed by Chemat |
[4-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]piperazin-1-yl]-phenylmethanone (CAS 302905-01-7) is a chemical compound with the molecular formula C21H21N3O2S and a molecular weight of 379.5 g/mol. IUPAC name: [4-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]piperazin-1-yl]-phenylmethanone. InChIKey: HXJLQFPFMYJEFO-UHFFFAOYSA-N.
| Molecular formula | C21H21N3O2S |
|---|---|
| Molecular weight | 379.5 g/mol |
| IUPAC name | [4-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]piperazin-1-yl]-phenylmethanone |
| InChIKey | HXJLQFPFMYJEFO-UHFFFAOYSA-N |
| SMILES | COC1=CC=C(C=C1)C2=CSC(=N2)N3CCN(CC3)C(=O)C4=CC=CC=C4 |
Computed by PubChem (NCBI)
Synonyms:
4-[2-(4-benzoyl-1-piperazinyl)-1,3-thiazol-4-yl]phenyl methyl ether, [4-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]piperazin-1-yl]-phenylmethanone, H-DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV-OH, (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt, (Lys22)-Amyloid beta-Protein (1-40) trifluoroacetate salt, {4-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]piperazin-1-yl}(phenyl)methanone